General Information

  • ID:  hor002396
  • Uniprot ID:  O18811
  • Protein name:  Motilin-associated peptide
  • Gene name:  MLN
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLSVWQRSGEEGPVDPAEPIEEEGNEMIKLTAPLEIGMRMNSRQLEKYRAALEGLLSEMLPQHAAK
  • Length:  66
  • Propeptide:  MVSRKAVAALLVVHAPAMLASQTEAFVPIFTYGELQRMQEKERSKGQKKSLSVWQRSGEEGPVDPAEPIEEEGNEMIKLTAPLEIGMRMNSRQLEKYRAALEGLLSEMLPQHAAK
  • Signal peptide:  MVSRKAVAALLVVHAPAMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  A0A5F7ZQL0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55090-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P55090-F1.pdbhor002396_AF2.pdbhor002396_ESM.pdb

Physical Information

Mass: 852295 Formula: C318H517N89O103S4
Absent amino acids: CF Common amino acids: E
pI: 4.41 Basic residues: 8
Polar residues: 14 Hydrophobic residues: 20
Hydrophobicity: -58.48 Boman Index: -12474
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.88
Instability Index: 5604.39 Extinction Coefficient cystines: 6990
Absorbance 280nm: 107.54

Literature

  • PubMed ID:  9762897
  • Title:  Isolation and Sequence of cDNA Encoding the Motilin Precursor From Monkey Intestine. Demonstration of the Motilin Precursor in the Monkey Brain